PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678378169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family ZF-HD
Protein Properties Length: 222aa    MW: 24607.4 Da    PI: 8.1661
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678378169genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer98.64.7e-313993358
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                 k +Y eClkNhAas+Ggha+DGCgEf+++ g +gt ++lkCaAC+CHRnFHR+e+e
    678378169 39 KSNYMECLKNHAASIGGHAFDGCGEFIAA-GGDGTLQSLKCAACNCHRNFHRKENE 93
                 679*************************9.8899*******************986 PP

2Homeobox15.53e-05156211152
                TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
   Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrR 52 
                +r Rt+f++eq e++ ++ e    k ++ ++e+ ++L ++lg++  + kvW +N +
  678378169 156 KRFRTKFSQEQKERMLSFSEslgwKIQKQDEESVQQLCNELGIKRHVLKVWMHNNK 211
                789************88777777779999**********************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-274192IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-184293IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.8E-284291IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.5924291IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.7E-30141214IPR009057Homeodomain-like
SuperFamilySSF466893.5E-20143213IPR009057Homeodomain-like
TIGRFAMsTIGR015651.9E-24155211IPR006455Homeodomain, ZF-HD class
CDDcd000860.00781156212No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MEFEDQDAGH DELPMSTNSG GGSSTAAKAE NYVPPPETKS NYMECLKNHA ASIGGHAFDG  60
CGEFIAAGGD GTLQSLKCAA CNCHRNFHRK ENEPGPSPLY LQQRQQMLLA ASHHNHGHYG  120
YRGQSGYFHV PPPLLALPSS SREDADERHS NPSGKKRFRT KFSQEQKERM LSFSESLGWK  180
IQKQDEESVQ QLCNELGIKR HVLKVWMHNN KRTLSGGGGK KT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A3e-231562111873ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097503.12e-83PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ6YXH56e-59ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLS8DMV23e-84S8DMV2_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_00s0199g00250.t012e-62(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.18e-55homeobox protein 22